IL7R alpha Antibody orb371682 from Biorbyt

Product Specs
ItemIL7R alpha Antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb371682
Quantity10 µg, 100 µg
ApplicationsFC, WB
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityHuman, Rat
TargetIL7R alpha
IsotypeRabbit IgG
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids
NCBI Full Gene Nameinterleukin 7 receptor
NCBI Gene AliasesCD127, CDW127, IL-7R-alpha, IL-7Ralpha, IL7RA, IL7Ralpha, ILRA, IMD104, lnc-IL7R, sIL-7R
ClonalityPolyclonal
HostRabbit
Molecular Weight51581 MW
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles

Specifications/Features

Application Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Western blot, 0.1-0.5µg/ml, Human, Rat Flow Cytometry, 1-3µg/1x106 cells, Human

Add to Compare List